Lineage for d2nr5c1 (2nr5 C:1-64)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 766018Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 767010Superfamily a.25.6: SO2669-like [158418] (1 family) (S)
    (homo)dimer of alpha-hairpin subunits similar to that of the half-ferritin family; no bound metals
  5. 767011Family a.25.6.1: SO2669-like [158419] (1 protein)
  6. 767012Protein Hypothetical protein SO2669 [158420] (1 species)
  7. 767013Species Shewanella oneidensis [TaxId:70863] [158421] (1 PDB entry)
    Uniprot Q8EDS4 1-64
  8. 767016Domain d2nr5c1: 2nr5 C:1-64 [148351]
    automatically matched to 2NR5 A:1-64
    complexed with act, mpd

Details for d2nr5c1

PDB Entry: 2nr5 (more details), 1.9 Å

PDB Description: Crystal Structure of Protein of Unknown Function SO2669 from Shewanella oneidensis MR-1
PDB Compounds: (C:) Hypothetical protein SO2669

SCOP Domain Sequences for d2nr5c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nr5c1 a.25.6.1 (C:1-64) Hypothetical protein SO2669 {Shewanella oneidensis [TaxId: 70863]}
mmtkkeriaiqrsmaeealgklkairqlcgaedssdssdmqeveiwtnrikeledwlwge
spia

SCOP Domain Coordinates for d2nr5c1:

Click to download the PDB-style file with coordinates for d2nr5c1.
(The format of our PDB-style files is described here.)

Timeline for d2nr5c1: