SCOPe 2.01: Domain d2nqbb1: 2nqb B:22-102

Lineage for d2nqbb1 (2nqb B:22-102)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (4 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H2A [47115] (7 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [187195] (1 PDB entry)

8. Domain d2nqbb1: 2nqb B:22-102 [148341]
   Other proteins in same PDB: d2nqba_, d2nqbe_
   automatically matched to d1p3ob_
   protein/DNA complex

Details for d2nqbb1

PDB Entry: 2nqb, 2.3 Å

PDB Description: drosophila nucleosome structure

PDB Compounds: (B:) histone h4

SCOPe Domain Sequences for d2nqbb1:

Sequence; same for both SEQRES and ATOM records:

>d2nqbb1 a.22.1.1 (B:22-102) Histone H2A {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
lrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktv
tamdvvyalkrqgrtlygfgg

Timeline for d2nqbb1:

• d2nqbb1 first appeared in SCOP 1.75
  
• d2nqbb1 is called d2nqbb_ in SCOPe 2.02
  
• d2nqbb1 appears in the current release, SCOPe 2.08, called d2nqbb_