Lineage for d2nqbb1 (2nqb B:22-102)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 909266Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 909267Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 909268Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 909269Protein Histone H2A [47115] (7 species)
  7. 909334Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [187195] (1 PDB entry)
  8. 909335Domain d2nqbb1: 2nqb B:22-102 [148341]
    Other proteins in same PDB: d2nqba_, d2nqbe_
    automatically matched to d1p3ob_
    protein/DNA complex

Details for d2nqbb1

PDB Entry: 2nqb (more details), 2.3 Å

PDB Description: Drosophila Nucleosome Structure
PDB Compounds: (B:) histone h4

SCOPe Domain Sequences for d2nqbb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nqbb1 a.22.1.1 (B:22-102) Histone H2A {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
lrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktv
tamdvvyalkrqgrtlygfgg

SCOPe Domain Coordinates for d2nqbb1:

Click to download the PDB-style file with coordinates for d2nqbb1.
(The format of our PDB-style files is described here.)

Timeline for d2nqbb1: