Lineage for d2np7a2 (2np7 A:244-413)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 882033Fold d.287: DNA methylase specificity domain [116733] (1 superfamily)
    comprises the N-terminal, double beta-helix like structure and C-terminal alpha-hairpin
  4. 882034Superfamily d.287.1: DNA methylase specificity domain [116734] (2 families) (S)
  5. 882035Family d.287.1.1: TaqI C-terminal domain-like [116735] (1 protein)
  6. 882036Protein DNA methylase TaqI, C-terminal domain [116736] (1 species)
  7. 882037Species Thermus aquaticus [TaxId:271] [116737] (12 PDB entries)
  8. 882043Domain d2np7a2: 2np7 A:244-413 [148337]
    Other proteins in same PDB: d2np7a1
    automatically matched to d1aqia2
    complexed with 3dr, 4pc, 6ma, gol, nea

Details for d2np7a2

PDB Entry: 2np7 (more details), 1.9 Å

PDB Description: crystal structure of the adenine-specific dna methyltransferase m.taqi complexed with the cofactor analog aeta and a 10 bp dna containing an abasic site analog at the target position and pyrrolo-dc at the target base partner position
PDB Compounds: (A:) modification methylase taqi

SCOP Domain Sequences for d2np7a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2np7a2 d.287.1.1 (A:244-413) DNA methylase TaqI, C-terminal domain {Thermus aquaticus [TaxId: 271]}
rfeteetrkleisgmplgdlfhirfaarspefkkhpavrkepgpglvpvltgrnlkpgwv
dyeknhsglwmpkerakelrdfyatphlvvahtkgtrvvaawderaypwreefhllpkeg
vrldpsslvqwlnseamqkhvrtlyrdfvphltlrmlerlpvrreygfht

SCOP Domain Coordinates for d2np7a2:

Click to download the PDB-style file with coordinates for d2np7a2.
(The format of our PDB-style files is described here.)

Timeline for d2np7a2: