![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.287: DNA methylase specificity domain [116733] (1 superfamily) comprises the N-terminal, double beta-helix like structure and C-terminal alpha-hairpin |
![]() | Superfamily d.287.1: DNA methylase specificity domain [116734] (2 families) ![]() |
![]() | Family d.287.1.1: TaqI C-terminal domain-like [116735] (2 proteins) |
![]() | Protein DNA methylase TaqI, C-terminal domain [116736] (1 species) |
![]() | Species Thermus aquaticus [TaxId:271] [116737] (11 PDB entries) |
![]() | Domain d2np7a2: 2np7 A:244-413 [148337] Other proteins in same PDB: d2np7a1 automatically matched to d1aqia2 protein/DNA complex; complexed with gol, nea |
PDB Entry: 2np7 (more details), 1.9 Å
SCOPe Domain Sequences for d2np7a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2np7a2 d.287.1.1 (A:244-413) DNA methylase TaqI, C-terminal domain {Thermus aquaticus [TaxId: 271]} rfeteetrkleisgmplgdlfhirfaarspefkkhpavrkepgpglvpvltgrnlkpgwv dyeknhsglwmpkerakelrdfyatphlvvahtkgtrvvaawderaypwreefhllpkeg vrldpsslvqwlnseamqkhvrtlyrdfvphltlrmlerlpvrreygfht
Timeline for d2np7a2: