![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.287: DNA methylase specificity domain [116733] (1 superfamily) comprises the N-terminal, double beta-helix like structure and C-terminal alpha-hairpin |
![]() | Superfamily d.287.1: DNA methylase specificity domain [116734] (2 families) ![]() |
![]() | Family d.287.1.1: TaqI C-terminal domain-like [116735] (1 protein) |
![]() | Protein DNA methylase TaqI, C-terminal domain [116736] (1 species) |
![]() | Species Thermus aquaticus [TaxId:271] [116737] (12 PDB entries) |
![]() | Domain d2np6d2: 2np6 D:244-413 [148335] Other proteins in same PDB: d2np6a1, d2np6d1 automatically matched to d1aqia2 complexed with 3dr, 6ma, gol, ipa, nea |
PDB Entry: 2np6 (more details), 2.1 Å
SCOP Domain Sequences for d2np6d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2np6d2 d.287.1.1 (D:244-413) DNA methylase TaqI, C-terminal domain {Thermus aquaticus [TaxId: 271]} rfeteetrkleisgmplgdlfhirfaarspefkkhpavrkepgpglvpvltgrnlkpgwv dyeknhsglwmpkerakelrdfyatphlvvahtkgtrvvaawderaypwreefhllpkeg vrldpsslvqwlnseamqkhvrtlyrdfvphltlrmlerlpvrreygfht
Timeline for d2np6d2: