| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.287: DNA methylase specificity domain [116733] (1 superfamily) comprises the N-terminal, double beta-helix like structure and C-terminal alpha-hairpin |
Superfamily d.287.1: DNA methylase specificity domain [116734] (2 families) ![]() |
| Family d.287.1.1: TaqI C-terminal domain-like [116735] (1 protein) |
| Protein DNA methylase TaqI, C-terminal domain [116736] (1 species) |
| Species Thermus aquaticus [TaxId:271] [116737] (12 PDB entries) |
| Domain d2np6a2: 2np6 A:244-413 [148333] Other proteins in same PDB: d2np6a1, d2np6d1 automatically matched to d1aqia2 protein/DNA complex; complexed with gol, ipa, nea |
PDB Entry: 2np6 (more details), 2.1 Å
SCOPe Domain Sequences for d2np6a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2np6a2 d.287.1.1 (A:244-413) DNA methylase TaqI, C-terminal domain {Thermus aquaticus [TaxId: 271]}
rfeteetrkleisgmplgdlfhirfaarspefkkhpavrkepgpglvpvltgrnlkpgwv
dyeknhsglwmpkerakelrdfyatphlvvahtkgtrvvaawderaypwreefhllpkeg
vrldpsslvqwlnseamqkhvrtlyrdfvphltlrmlerlpvrreygfht
Timeline for d2np6a2: