| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) ![]() |
| Family c.66.1.27: DNA methylase TaqI, N-terminal domain [88787] (1 protein) |
| Protein DNA methylase TaqI, N-terminal domain [53369] (1 species) |
| Species Thermus aquaticus [TaxId:271] [53370] (12 PDB entries) |
| Domain d2np6a1: 2np6 A:21-243 [148332] Other proteins in same PDB: d2np6a2, d2np6d2 automatically matched to d1aqia1 protein/DNA complex; complexed with gol, ipa, nea |
PDB Entry: 2np6 (more details), 2.1 Å
SCOPe Domain Sequences for d2np6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2np6a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]}
vetppevvdfmvslaeaprggrvlepacahgpflrafreahgtayrfvgveidpkaldlp
pwaegiladfllwepgeafdlilgnppygivgeaskypihvfkavkdlykkafstwkgky
nlygaflekavrllkpggvlvfvvpatwlvledfallreflaregktsvyylgevfpqkk
vsavvirfqksgkglslwdtqesesgftpilwaeyphwegeii
Timeline for d2np6a1: