Lineage for d2nojg_ (2noj G:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 920404Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 920721Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (4 families) (S)
  5. 920975Family a.102.4.4: Complement components [48251] (3 proteins)
    probably related to other families, but has no known enzymatic activity
  6. 920976Protein C3D, a C3 fragment and ligand for complement receptor 2 [48252] (2 species)
  7. 920977Species Human (Homo sapiens) [TaxId:9606] [48253] (8 PDB entries)
  8. 920989Domain d2nojg_: 2noj G: [148330]
    Other proteins in same PDB: d2nojb1, d2nojd1, d2nojf1, d2nojh1
    automated match to d1c3da_

Details for d2nojg_

PDB Entry: 2noj (more details), 2.7 Å

PDB Description: crystal structure of ehp / c3d complex
PDB Compounds: (G:) Complement C3

SCOPe Domain Sequences for d2nojg_:

Sequence, based on SEQRES records: (download)

>d2nojg_ a.102.4.4 (G:) C3D, a C3 fragment and ligand for complement receptor 2 {Human (Homo sapiens) [TaxId: 9606]}
aerlkhlivtpsgageqnmigmtptviavhyldeteqwekfglekrqgalelikkgytqq
lafrqpssafaafvkrapstwltayvvkvfslavnliaidsqvlcgavkwlilekqkpdg
vfqedapvihqemigglrnnnekdmaltafvlislqeakdiceeqvnslpgsitkagdfl
eanymnlqrsytvaiagyalaqmgrlkgpllnkflttakdknrwedpgkqlynveatsya
llallqlkdfdfvppvvrwlneqryygggygstqatfmvfqalaqyqkda

Sequence, based on observed residues (ATOM records): (download)

>d2nojg_ a.102.4.4 (G:) C3D, a C3 fragment and ligand for complement receptor 2 {Human (Homo sapiens) [TaxId: 9606]}
aerlkhlivtpsgageqnmigmtptviavhyldeteqwekfglekrqgalelikkgytqq
lafrqpssafaafvkrapstwltayvvkvfslavnliaidsqvlcgavkwlilekqkpdg
vfqedapvihqemigglrnnnekdmaltafvlislqeakdiceeqvnslpgsitkagdfl
eanymnlqrsytvaiagyaqmgrlkgpllnkflttakdrwedpgkqlynveatsyallal
lqkdffvppvvrwlneqryygggygstqatfmvfqalaqyqkda

SCOPe Domain Coordinates for d2nojg_:

Click to download the PDB-style file with coordinates for d2nojg_.
(The format of our PDB-style files is described here.)

Timeline for d2nojg_: