Class a: All alpha proteins [46456] (289 folds) |
Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.7.17: Efb C-domain-like [158366] (1 family) automatically mapped to Pfam PF12199 |
Family a.7.17.1: Efb C-domain-like [158367] (2 proteins) PfamB PB008033 this is a repeat family; one repeat unit is 2gom A:105-165 found in domain |
Protein Uncharacterized protein SAV1155 [158370] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [158371] (1 PDB entry) Uniprot Q99UV2 52-109 |
Domain d2nojf_: 2noj F: [148329] Other proteins in same PDB: d2noja_, d2nojc_, d2noje_, d2nojg_ automated match to d2nojb1 |
PDB Entry: 2noj (more details), 2.7 Å
SCOPe Domain Sequences for d2nojf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nojf_ a.7.17.1 (F:) Uncharacterized protein SAV1155 {Staphylococcus aureus [TaxId: 1280]} nkkvvdaqkavelfkrtrtvathrkaqravnlihfqhsyekkklqrqidlvlkyntlk
Timeline for d2nojf_: