Lineage for d2noja1 (2noj A:1001-1286)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 774162Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 774411Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (4 families) (S)
  5. 774650Family a.102.4.4: Complement components [48251] (2 proteins)
    probably related to other families, but has no known enzymatic activity
  6. 774651Protein C3D, a C3 fragment and ligand for complement receptor 2 [48252] (2 species)
  7. 774652Species Human (Homo sapiens) [TaxId:9606] [48253] (6 PDB entries)
  8. 774659Domain d2noja1: 2noj A:1001-1286 [148324]
    Other proteins in same PDB: d2nojb1, d2nojd1, d2nojf1, d2nojh1
    automatically matched to d1ghqa_
    mutant

Details for d2noja1

PDB Entry: 2noj (more details), 2.7 Å

PDB Description: Crystal structure of Ehp / C3d complex
PDB Compounds: (A:) Complement C3

SCOP Domain Sequences for d2noja1:

Sequence, based on SEQRES records: (download)

>d2noja1 a.102.4.4 (A:1001-1286) C3D, a C3 fragment and ligand for complement receptor 2 {Human (Homo sapiens) [TaxId: 9606]}
khlivtpsgageqnmigmtptviavhyldeteqwekfglekrqgalelikkgytqqlafr
qpssafaafvkrapstwltayvvkvfslavnliaidsqvlcgavkwlilekqkpdgvfqe
dapvihqemigglrnnnekdmaltafvlislqeakdiceeqvnslpgsitkagdfleany
mnlqrsytvaiagyalaqmgrlkgpllnkflttakdknrwedpgkqlynveatsyallal
lqlkdfdfvppvvrwlneqryygggygstqatfmvfqalaqyqkda

Sequence, based on observed residues (ATOM records): (download)

>d2noja1 a.102.4.4 (A:1001-1286) C3D, a C3 fragment and ligand for complement receptor 2 {Human (Homo sapiens) [TaxId: 9606]}
khlivtpsgageqnmigmtptviavhyldeteqwekfglekrqgalelikkgytqqlafr
qpssafaafvkrapstwltayvvkvfslavnliaidsqvlcgavkwlilekqkpdgvfqe
dapvihqemigglrnnnekdmaltafvlislqeakdiceeqvnslpgsitkagdfleany
mnlqrsytvaiagyalaqmgpllnkflttakdknrwedpgkqlynveatsyallallqlk
dfdfvppvvrwlneqgygstqatfmvfqalaqyqkda

SCOP Domain Coordinates for d2noja1:

Click to download the PDB-style file with coordinates for d2noja1.
(The format of our PDB-style files is described here.)

Timeline for d2noja1: