Lineage for d2nnab2 (2nna B:7-92)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1020838Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1020839Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 1020840Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1021417Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 1021448Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [88822] (13 PDB entries)
    Uniprot P04229 30-219
  8. 1021451Domain d2nnab2: 2nna B:7-92 [148316]
    Other proteins in same PDB: d2nnab1
    automatically matched to d1bx2b2

Details for d2nnab2

PDB Entry: 2nna (more details), 2.1 Å

PDB Description: Structure of the MHC class II molecule HLA-DQ8 bound with a deamidated gluten peptide
PDB Compounds: (B:) MHC class II antigen

SCOPe Domain Sequences for d2nnab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nnab2 d.19.1.1 (B:7-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR2 [TaxId: 9606]}
fvyqfkgmcyftngtervrlvtryiynreeyarfdsdvgvyravtplgppaaeywnsqke
vlertraeldtvcrhnyqlelrttlq

SCOPe Domain Coordinates for d2nnab2:

Click to download the PDB-style file with coordinates for d2nnab2.
(The format of our PDB-style files is described here.)

Timeline for d2nnab2: