Class a: All alpha proteins [46456] (286 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
Protein Calmodulin [47516] (12 species) |
Species African clawed frog (Xenopus laevis) [TaxId:8355] [47521] (13 PDB entries) |
Domain d2k3sb1: 2k3s B:82-148 [148267] Other proteins in same PDB: d2k3sa_ automatically matched to d1cmfa_ |
PDB Entry: 2k3s (more details)
SCOPe Domain Sequences for d2k3sb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2k3sb1 a.39.1.5 (B:82-148) Calmodulin {African clawed frog (Xenopus laevis) [TaxId: 8355]} eeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevdemireadidgdgqvnyeef vqmmtak
Timeline for d2k3sb1: