SCOPe 2.04: Domain d2k3sb1: 2k3s B:82-148

Lineage for d2k3sb1 (2k3s B:82-148)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Calmodulin [47516] (12 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [47521] (15 PDB entries)

8. Domain d2k3sb1: 2k3s B:82-148 [148267]
   Other proteins in same PDB: d2k3sa_
   automatically matched to d1cmfa_

Details for d2k3sb1

PDB Entry: 2k3s

PDB Description: haddock-derived structure of the ch-domain of the smoothelin-like 1 complexed with the c-domain of apocalmodulin

PDB Compounds: (B:) calmodulin

SCOPe Domain Sequences for d2k3sb1:

Sequence; same for both SEQRES and ATOM records:

>d2k3sb1 a.39.1.5 (B:82-148) Calmodulin {African clawed frog (Xenopus laevis) [TaxId: 8355]}
eeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevdemireadidgdgqvnyeef
vqmmtak

Timeline for d2k3sb1:

• d2k3sb1 first appeared in SCOP 1.75
  
• d2k3sb1 appears in SCOPe 2.03
  
• d2k3sb1 appears in SCOPe 2.05
  
• d2k3sb1 appears in the current release, SCOPe 2.08