Lineage for d2k3sb1 (2k3s B:82-148)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710548Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2710608Protein Calmodulin [47516] (13 species)
  7. 2710609Species African clawed frog (Xenopus laevis) [TaxId:8355] [47521] (20 PDB entries)
  8. 2710616Domain d2k3sb1: 2k3s B:82-148 [148267]
    Other proteins in same PDB: d2k3sa1, d2k3sa2
    automatically matched to d1cmfa_
    fragment; missing more than one-third of the common structure and/or sequence

Details for d2k3sb1

PDB Entry: 2k3s (more details)

PDB Description: haddock-derived structure of the ch-domain of the smoothelin-like 1 complexed with the c-domain of apocalmodulin
PDB Compounds: (B:) calmodulin

SCOPe Domain Sequences for d2k3sb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2k3sb1 a.39.1.5 (B:82-148) Calmodulin {African clawed frog (Xenopus laevis) [TaxId: 8355]}
eeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevdemireadidgdgqvnyeef
vqmmtak

SCOPe Domain Coordinates for d2k3sb1:

Click to download the PDB-style file with coordinates for d2k3sb1.
(The format of our PDB-style files is described here.)

Timeline for d2k3sb1: