Lineage for d2k3ka1 (2k3k A:1-104)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1908438Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1908439Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 1908745Protein Splicesomal U1A protein [54932] (2 species)
    duplication: contains two domains of this fold
  7. 1908746Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [160313] (3 PDB entries)
    Uniprot P43332 1-104! Uniprot P43332 134-216
  8. 1908748Domain d2k3ka1: 2k3k A:1-104 [148266]
    1st RBD

Details for d2k3ka1

PDB Entry: 2k3k (more details)

PDB Description: Solution structure of Drosophila melanogaster SNF RBD1
PDB Compounds: (A:) U1 small nuclear ribonucleoprotein A

SCOPe Domain Sequences for d2k3ka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2k3ka1 d.58.7.1 (A:1-104) Splicesomal U1A protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
memlpnqtiyinnlnekikkeelkkslyaifsqfgqildivalktlkmrgqafvifkeig
sasnalrtmqgfpfydkpmqiaysksdsdivakikgtfkerpkk

SCOPe Domain Coordinates for d2k3ka1:

Click to download the PDB-style file with coordinates for d2k3ka1.
(The format of our PDB-style files is described here.)

Timeline for d2k3ka1: