SCOPe 2.08: Domain d2k1ja2: 2k1j A:188-249

Lineage for d2k1ja2 (2k1j A:188-249)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies)
   dimetal(zinc)-bound alpha+beta fold

4. Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families)

5. Family g.50.1.2: PHD domain [57911] (14 proteins)

6. Protein Inhibitor of growth protein 4, Ing4 [118334] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [161223] (3 PDB entries)

8. Domain d2k1ja2: 2k1j A:188-249 [148257]
   Other proteins in same PDB: d2k1ja3
   automated match to d1wena_
   complexed with zn

Details for d2k1ja2

PDB Entry: 2k1j

PDB Description: plan homeodomain finger of tumour supressor ing4

PDB Compounds: (A:) Inhibitor of growth protein 4

SCOPe Domain Sequences for d2k1ja2:

Sequence; same for both SEQRES and ATOM records:

>d2k1ja2 g.50.1.2 (A:188-249) Inhibitor of growth protein 4, Ing4 {Human (Homo sapiens) [TaxId: 9606]}
dmpvdpneptyclchqvsygemigcdnpdcsiewfhfacvglttkprgkwfcprcsqerk
kk

Timeline for d2k1ja2:

• d2k1ja2 first appeared in SCOP 1.75, called d2k1ja1
  
• d2k1ja2 was called d2k1ja_ in SCOPe 2.07