Class g: Small proteins [56992] (100 folds) |
Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies) dimetal(zinc)-bound alpha+beta fold |
Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) |
Family g.50.1.2: PHD domain [57911] (14 proteins) |
Protein Inhibitor of growth protein 4, Ing4 [118334] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [161223] (3 PDB entries) |
Domain d2k1ja2: 2k1j A:188-249 [148257] Other proteins in same PDB: d2k1ja3 automated match to d1wena_ complexed with zn |
PDB Entry: 2k1j (more details)
SCOPe Domain Sequences for d2k1ja2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2k1ja2 g.50.1.2 (A:188-249) Inhibitor of growth protein 4, Ing4 {Human (Homo sapiens) [TaxId: 9606]} dmpvdpneptyclchqvsygemigcdnpdcsiewfhfacvglttkprgkwfcprcsqerk kk
Timeline for d2k1ja2: