Class a: All alpha proteins [46456] (289 folds) |
Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies) 3 helices; bundle, right-handed twist |
Superfamily a.5.2: UBA-like [46934] (5 families) |
Family a.5.2.1: UBA domain [46935] (25 proteins) |
Protein Sequestosome 1 (Sqstm1) [101063] (1 species) ubiquitin-binding protein p62 |
Species Human (Homo sapiens) [TaxId:9606] [101064] (5 PDB entries) |
Domain d2k0bx2: 2k0b X:3-52 [148253] Other proteins in same PDB: d2k0bx3 automated match to d2k0bx1 |
PDB Entry: 2k0b (more details)
SCOPe Domain Sequences for d2k0bx2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2k0bx2 a.5.2.1 (X:3-52) Sequestosome 1 (Sqstm1) {Human (Homo sapiens) [TaxId: 9606]} ppeadprlieslsqmlsmgfsdeggwltrllqtknydigaaldtiqyskh
Timeline for d2k0bx2: