Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) |
Family d.58.7.1: Canonical RBD [54929] (68 proteins) |
Protein Negative elongation factor E, NELF-E [143302] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [143303] (3 PDB entries) Uniprot P18615 257-335! Uniprot P18615 258-341 |
Domain d2jx2a_: 2jx2 A: [148233] automated match to d1x5pa1 |
PDB Entry: 2jx2 (more details)
SCOPe Domain Sequences for d2jx2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jx2a_ d.58.7.1 (A:) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} aprkgntlyvygedmtptllrgafspfgniidlsmdpprncafvtyekmesadqavaeln gtqvesvqlkvniarkqpmldaatgks
Timeline for d2jx2a_: