Lineage for d2jx2a_ (2jx2 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1908438Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1908439Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 1908549Protein Negative elongation factor E, NELF-E [143302] (1 species)
  7. 1908550Species Human (Homo sapiens) [TaxId:9606] [143303] (3 PDB entries)
    Uniprot P18615 257-335! Uniprot P18615 258-341
  8. 1908552Domain d2jx2a_: 2jx2 A: [148233]
    automated match to d1x5pa1

Details for d2jx2a_

PDB Entry: 2jx2 (more details)

PDB Description: solution conformation of rna-bound nelf-e rrm
PDB Compounds: (A:) negative elongation factor e

SCOPe Domain Sequences for d2jx2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jx2a_ d.58.7.1 (A:) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]}
aprkgntlyvygedmtptllrgafspfgniidlsmdpprncafvtyekmesadqavaeln
gtqvesvqlkvniarkqpmldaatgks

SCOPe Domain Coordinates for d2jx2a_:

Click to download the PDB-style file with coordinates for d2jx2a_.
(The format of our PDB-style files is described here.)

Timeline for d2jx2a_: