Lineage for d2jwza1 (2jwz A:1-71)

  1. Root: SCOP 1.75
  2. 900990Class k: Designed proteins [58788] (44 folds)
  3. 901726Fold k.45: Ubiquitin [144344] (1 superfamily)
  4. 901727Superfamily k.45.1: Ubiquitin [144345] (1 family) (S)
  5. 901728Family k.45.1.1: Ubiquitin [144346] (1 protein)
  6. 901729Protein Ubiquitin [144347] (4 species)
  7. 901737Species Saccharomyces cerevisiae [TaxId:4932] [161335] (1 PDB entry)
  8. 901738Domain d2jwza1: 2jwz A:1-71 [148232]
    automatically matched to d1yiwa1

Details for d2jwza1

PDB Entry: 2jwz (more details)

PDB Description: Mutations in the hydrophobic core of ubiquitin differentially affect its recognition by receptor proteins
PDB Compounds: (A:) Ubiquitin

SCOP Domain Sequences for d2jwza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jwza1 k.45.1.1 (A:1-71) Ubiquitin {Saccharomyces cerevisiae [TaxId: 4932]}
mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsdyn
iqkestlhsvl

SCOP Domain Coordinates for d2jwza1:

Click to download the PDB-style file with coordinates for d2jwza1.
(The format of our PDB-style files is described here.)

Timeline for d2jwza1: