Lineage for d2jvca1 (2jvc A:6-76)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1892544Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1892545Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1892546Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1893246Protein automated matches [190118] (9 species)
    not a true protein
  7. 1893437Species Paramecium tetraurelia strain d4-2 [TaxId:412030] [161334] (1 PDB entry)
  8. 1893438Domain d2jvca1: 2jvc A:6-76 [148222]
    automatically matched to d1yiwa1

Details for d2jvca1

PDB Entry: 2jvc (more details)

PDB Description: NMR solution structure of ubiquitin like protein
PDB Compounds: (A:) ubiquitin_like protein

SCOPe Domain Sequences for d2jvca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jvca1 d.15.1.1 (A:6-76) automated matches {Paramecium tetraurelia strain d4-2 [TaxId: 412030]}
mqifvktltgktitidvdhadtvgavkakiydkegippdqqrlifggkqledsnamsdyn
vqkestlhlvl

SCOPe Domain Coordinates for d2jvca1:

Click to download the PDB-style file with coordinates for d2jvca1.
(The format of our PDB-style files is described here.)

Timeline for d2jvca1: