SCOPe 2.08: Domain d2jtoa2: 2jto A:38-75

Lineage for d2jtoa2 (2jto A:38-75)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.9: Defensin-like [57391] (1 superfamily)
   Disulfide-rich fold, nearly all-beta

4. Superfamily g.9.1: Defensin-like [57392] (3 families)

5. Family g.9.1.3: Tick carboxypeptidase inhibitor-like [161135] (2 proteins)

6. Protein automated matches [254564] (1 species)
   not a true protein

7. Species Rhipicephalus bursa [255296] (2 PDB entries)

8. Domain d2jtoa2: 2jto A:38-75 [148204]
   automated match to d3d4ub2

Details for d2jtoa2

PDB Entry: 2jto

PDB Description: solution structure of tick carboxypeptidase inhibitor

PDB Compounds: (A:) carboxypeptidase inhibitor

SCOPe Domain Sequences for d2jtoa2:

Sequence; same for both SEQRES and ATOM records:

>d2jtoa2 g.9.1.3 (A:38-75) automated matches {Rhipicephalus bursa}
tgckgkggecnpldrqckelqaesascgkgqkccvwlh

Timeline for d2jtoa2:

• d2jtoa2 first appeared in SCOP 1.75
  
• d2jtoa2 appears in SCOPe 2.07