Lineage for d2jtoa2 (2jto A:38-75)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3032898Fold g.9: Defensin-like [57391] (1 superfamily)
    Disulfide-rich fold, nearly all-beta
  4. 3032899Superfamily g.9.1: Defensin-like [57392] (3 families) (S)
  5. 3033045Family g.9.1.3: Tick carboxypeptidase inhibitor-like [161135] (2 proteins)
  6. 3033056Protein automated matches [254564] (1 species)
    not a true protein
  7. 3033057Species Rhipicephalus bursa [255296] (2 PDB entries)
  8. 3033061Domain d2jtoa2: 2jto A:38-75 [148204]
    automated match to d3d4ub2

Details for d2jtoa2

PDB Entry: 2jto (more details)

PDB Description: solution structure of tick carboxypeptidase inhibitor
PDB Compounds: (A:) carboxypeptidase inhibitor

SCOPe Domain Sequences for d2jtoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jtoa2 g.9.1.3 (A:38-75) automated matches {Rhipicephalus bursa}
tgckgkggecnpldrqckelqaesascgkgqkccvwlh

SCOPe Domain Coordinates for d2jtoa2:

Click to download the PDB-style file with coordinates for d2jtoa2.
(The format of our PDB-style files is described here.)

Timeline for d2jtoa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2jtoa1