SCOPe 2.06: Domain d2jt8a_: 2jt8 A:

Lineage for d2jt8a_ (2jt8 A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein automated matches [190064] (21 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186813] (24 PDB entries)

8. Domain d2jt8a_: 2jt8 A: [148201]
   automated match to d1br1b_
   mutant

Details for d2jt8a_

PDB Entry: 2jt8

PDB Description: solution structure of the f153-to-5-flurotryptophan mutant of human cardiac troponin c

PDB Compounds: (A:) troponin c, slow skeletal and cardiac muscles

SCOPe Domain Sequences for d2jt8a_:

Sequence; same for both SEQRES and ATOM records:

>d2jt8a_ a.39.1.5 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mddiykaaveqlteeqknefkaafdifvlgaedgsistkelgkvmrmlgqnptpeelqem
idevdedgsgtvdfdeflvmmvrsmkddskgkseeelsdlfrmfdknadgyidldelkim
lqatgetiteddieelmkdgdknndgridydewlefmkgve

Timeline for d2jt8a_:

• d2jt8a_ first appeared in SCOP 1.75, called d2jt8a1
  
• d2jt8a_ appears in SCOPe 2.05
  
• d2jt8a_ appears in SCOPe 2.07
  
• d2jt8a_ appears in the current release, SCOPe 2.08