Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (9 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein Ubiquitin [54238] (7 species) |
Species Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId:4932] [89830] (7 PDB entries) |
Domain d2jt4b1: 2jt4 B:1-76 [148198] automatically matched to d1otrb_ protein/DNA complex |
PDB Entry: 2jt4 (more details)
SCOPe Domain Sequences for d2jt4b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jt4b1 d.15.1.1 (B:1-76) Ubiquitin {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsdyn iqkestlhlvlrlrgg
Timeline for d2jt4b1: