![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (8 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (38 proteins) Pfam PF00240 |
![]() | Protein Ubiquitin [54238] (3 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId:4932] [89830] (6 PDB entries) |
![]() | Domain d2jt4b1: 2jt4 B:1-76 [148198] automatically matched to d1otrb_ |
PDB Entry: 2jt4 (more details)
SCOP Domain Sequences for d2jt4b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jt4b1 d.15.1.1 (B:1-76) Ubiquitin {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsdyn iqkestlhlvlrlrgg
Timeline for d2jt4b1: