SCOP 1.75: Domain d2jt4b1: 2jt4 B:1-76

Lineage for d2jt4b1 (2jt4 B:1-76)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (8 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (38 proteins)
   Pfam PF00240

6. Protein Ubiquitin [54238] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId:4932] [89830] (6 PDB entries)

8. Domain d2jt4b1: 2jt4 B:1-76 [148198]
   automatically matched to d1otrb_

Details for d2jt4b1

PDB Entry: 2jt4

PDB Description: solution structure of the sla1 sh3-3-ubiquitin complex

PDB Compounds: (B:) Ubiquitin

SCOP Domain Sequences for d2jt4b1:

Sequence; same for both SEQRES and ATOM records:

>d2jt4b1 d.15.1.1 (B:1-76) Ubiquitin {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]}
mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsdyn
iqkestlhlvlrlrgg

Timeline for d2jt4b1:

• d2jt4b1 is new in SCOP 1.75
  
• d2jt4b1 appears in SCOPe 2.01
  
• d2jt4b1 appears in the current release, SCOPe 2.08, called d2jt4b_