Class i: Low resolution protein structures [58117] (26 folds) |
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) |
Family i.1.1.1: Ribosome complexes [58120] (1 protein) |
Protein 70S ribosome functional complex [58121] (9 species) |
Species Thermotoga maritima Huber et al. 1986 (Thermotoga maritima) [TaxId:2336] [161274] (2 PDB entries) |
Domain d2jq7a1: 2jq7 A:8-140 [148171] automatically matched to d1eg0k_ |
PDB Entry: 2jq7 (more details)
SCOP Domain Sequences for d2jq7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jq7a1 i.1.1.1 (A:8-140) 70S ribosome functional complex {Thermotoga maritima Huber et al. 1986 (Thermotoga maritima) [TaxId: 2336]} qiklqlpagkatpappvgpalgqhgvnimefckrfnaetadkagmilpvvitvyedksft fiiktppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnansleaamki iegtaksmgievv
Timeline for d2jq7a1: