Lineage for d2jnba1 (2jnb A:4-128)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1032069Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1032367Superfamily d.79.3: L30e-like [55315] (3 families) (S)
  5. 1032368Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins)
  6. 1032469Protein Spliceosomal 15.5kd protein [55321] (1 species)
  7. 1032470Species Human (Homo sapiens) [TaxId:9606] [55322] (3 PDB entries)
  8. 1032475Domain d2jnba1: 2jnb A:4-128 [148148]
    automatically matched to d1e7ka_

Details for d2jnba1

PDB Entry: 2jnb (more details)

PDB Description: Solution Structure of RNA-binding protein 15.5K
PDB Compounds: (A:) NHP2-like protein 1

SCOPe Domain Sequences for d2jnba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jnba1 d.79.3.1 (A:4-128) Spliceosomal 15.5kd protein {Human (Homo sapiens) [TaxId: 9606]}
advnpkaypladahltkklldlvqqscnykqlrkganeatktlnrgisefivmaadaepl
eiilhlpllcedknvpyvfvrskqalgracgvsrpviacsvtikegsqlkqqiqsiqqsi
erllv

SCOPe Domain Coordinates for d2jnba1:

Click to download the PDB-style file with coordinates for d2jnba1.
(The format of our PDB-style files is described here.)

Timeline for d2jnba1: