Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest |
Superfamily c.49.2: ATP synthase (F1-ATPase), gamma subunit [52943] (2 families) contains an antiparallel coiled coil formed by N- and C-terminal extensions to the common fold |
Family c.49.2.1: ATP synthase (F1-ATPase), gamma subunit [52944] (1 protein) automatically mapped to Pfam PF00231 |
Protein F1 ATP synthase gamma subunit [52945] (4 species) |
Species Cow (Bos taurus) [TaxId:9913] [52946] (19 PDB entries) Uniprot P05631 |
Domain d2jj1g_: 2jj1 G: [148123] Other proteins in same PDB: d2jj1a1, d2jj1a2, d2jj1a3, d2jj1b1, d2jj1b2, d2jj1b3, d2jj1c1, d2jj1c2, d2jj1c3, d2jj1d1, d2jj1d2, d2jj1d3, d2jj1e1, d2jj1e2, d2jj1e3, d2jj1f1, d2jj1f2, d2jj1f3, d2jj1h1, d2jj1h2, d2jj1h3, d2jj1i1, d2jj1i2, d2jj1i3, d2jj1j1, d2jj1j2, d2jj1j3, d2jj1k1, d2jj1k2, d2jj1k3, d2jj1l1, d2jj1l2, d2jj1l3, d2jj1m1, d2jj1m2, d2jj1m3 automated match to d1bmfg_ complexed with adp, anp, azi, gol, mg, pit, po4 |
PDB Entry: 2jj1 (more details), 2.7 Å
SCOPe Domain Sequences for d2jj1g_:
Sequence, based on SEQRES records: (download)
>d2jj1g_ c.49.2.1 (G:) F1 ATP synthase gamma subunit {Cow (Bos taurus) [TaxId: 9913]} atlkditrrlksikniqkitksmkmvaaakyaraerelkparvygvgslalyekadiktp edkkkhliigvssdrglcgaihssvakqmkseaanlaaagkevkiigvgdkirsilhrth sdqflvtfkevgrrpptfgdasvialellnsgyefdegsiifnrfrsvisykteekpifs ldtissaesmsiyddidadvlrnyqeyslaniiyyslkesttseqsarmtamdnasknas emidkltltfnrtrqavitkelieiisgaaal
>d2jj1g_ c.49.2.1 (G:) F1 ATP synthase gamma subunit {Cow (Bos taurus) [TaxId: 9913]} atlkditrrlksikniqkitksmkmvaaakyaraerelkparvygvgssdrglcgaihss vakqmigvgdkirsikevgrrpptfgdifnrfrsvisykteyslaniiyyslkesttseq sarmtamdnasknasemidkltltfnrtrqavitkelieiisgaaal
Timeline for d2jj1g_:
View in 3D Domains from other chains: (mouse over for more information) d2jj1a1, d2jj1a2, d2jj1a3, d2jj1b1, d2jj1b2, d2jj1b3, d2jj1c1, d2jj1c2, d2jj1c3, d2jj1d1, d2jj1d2, d2jj1d3, d2jj1e1, d2jj1e2, d2jj1e3, d2jj1f1, d2jj1f2, d2jj1f3, d2jj1h1, d2jj1h2, d2jj1h3, d2jj1i1, d2jj1i2, d2jj1i3, d2jj1j1, d2jj1j2, d2jj1j3, d2jj1k1, d2jj1k2, d2jj1k3, d2jj1l1, d2jj1l2, d2jj1l3, d2jj1m1, d2jj1m2, d2jj1m3, d2jj1n_ |