SCOPe 2.03: Domain d2jj0l_: 2jj0 L:

Lineage for d2jj0l_ (2jj0 L:)

1. Root: SCOPe 2.03

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein automated matches [190224] (5 species)
   not a true protein

7. Species Rhodobacter sphaeroides [TaxId:1063] [186985] (31 PDB entries)

8. Domain d2jj0l_: 2jj0 L: [148122]
   Other proteins in same PDB: d2jj0h1, d2jj0h2
   automated match to d1aigl_
   complexed with bcl, bph, cdl, cl, fe, spn, u10; mutant

Details for d2jj0l_

PDB Entry: 2jj0, 2.8 Å

PDB Description: photosynthetic reaction center mutant with ala m248 replaced with trp (chain m, am248w)

PDB Compounds: (L:) reaction center protein l chain

SCOPe Domain Sequences for d2jj0l_:

Sequence; same for both SEQRES and ATOM records:

>d2jj0l_ f.26.1.1 (L:) automated matches {Rhodobacter sphaeroides [TaxId: 1063]}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

Timeline for d2jj0l_:

• d2jj0l_ first appeared in SCOP 1.75, called d2jj0l1
  
• d2jj0l_ appears in SCOPe 2.02
  
• d2jj0l_ appears in SCOPe 2.04
  
• d2jj0l_ appears in the current release, SCOPe 2.08