Lineage for d2jizg_ (2jiz G:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1371047Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest
  4. 1371195Superfamily c.49.2: ATP synthase (F1-ATPase), gamma subunit [52943] (2 families) (S)
    contains an antiparallel coiled coil formed by N- and C-terminal extensions to the common fold
  5. 1371196Family c.49.2.1: ATP synthase (F1-ATPase), gamma subunit [52944] (1 protein)
    automatically mapped to Pfam PF00231
  6. 1371197Protein ATP synthase (F1-ATPase), gamma subunit [52945] (3 species)
  7. 1371198Species Cow (Bos taurus) [TaxId:9913] [52946] (19 PDB entries)
    Uniprot P05631
  8. 1371202Domain d2jizg_: 2jiz G: [148120]
    Other proteins in same PDB: d2jizd1, d2jizd2, d2jizd3, d2jize1, d2jize2, d2jize3, d2jizf1, d2jizf2, d2jizf3, d2jizk1, d2jizk2, d2jizk3, d2jizl1, d2jizl2, d2jizl3, d2jizm1, d2jizm2, d2jizm3
    automated match to d1bmfg_
    complexed with adp, anp, azi, gol, mg, po4, stl

Details for d2jizg_

PDB Entry: 2jiz (more details), 2.3 Å

PDB Description: the structure of f1-atpase inhibited by resveratrol.
PDB Compounds: (G:) ATP synthase gamma chain

SCOPe Domain Sequences for d2jizg_:

Sequence, based on SEQRES records: (download)

>d2jizg_ c.49.2.1 (G:) ATP synthase (F1-ATPase), gamma subunit {Cow (Bos taurus) [TaxId: 9913]}
atlkditrrlksikniqkitksmkmvaaakyaraerelkparvygvgslalyekadiktp
edkkkhliigvssdrglcgaihssvakqmkseaanlaaagkevkiigvgdkirsilhrth
sdqflvtfkevgrrpptfgdasvialellnsgyefdegsiifnrfrsvisykteekpifs
ldtissaesmsiyddidadvlrnyqeyslaniiyyslkesttseqsarmtamdnasknas
emidkltltfnrtrqavitkelieiisgaaal

Sequence, based on observed residues (ATOM records): (download)

>d2jizg_ c.49.2.1 (G:) ATP synthase (F1-ATPase), gamma subunit {Cow (Bos taurus) [TaxId: 9913]}
atlkditrrlksikniqkitksmkmvaaakyaraerelkparvygvgliigvssdrglcg
aihssvakqmkiigvgdkirsiltfkevgrrpptfgdasvialelsiifnrfrsvisykt
lrnyqeyslaniiyyslkesttseqsarmtamdnasknasemidkltltfnrtrqavitk
elieiisgaaal

SCOPe Domain Coordinates for d2jizg_:

Click to download the PDB-style file with coordinates for d2jizg_.
(The format of our PDB-style files is described here.)

Timeline for d2jizg_: