SCOPe 2.05: Domain d2jixb2: 2jix B:117-224

Lineage for d2jixb2 (2jix B:117-224)

Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.2: Fibronectin type III [49265] (2 families)
Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
Pfam PF00041
Protein Erythropoietin (EPO) receptor [49282] (1 species)
Species Human (Homo sapiens) [TaxId:9606] [49283] (6 PDB entries)
Domain d2jixb2: 2jix B:117-224 [148108]
Other proteins in same PDB: d2jixd1, d2jixd2, d2jixf1, d2jixf2, d2jixh1, d2jixh2
automatically matched to d1ebaa2

Details for d2jixb2

PDB Entry: 2jix (more details), 3.2 Å

PDB Description: crystal structure of abt-007 fab fragment with the soluble domain of epo receptor

PDB Compounds: (B:) erythropoietin receptor

SCOPe Domain Sequences for d2jixb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jixb2 b.1.2.1 (B:117-224) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]}
evvlldapvglvarladesghvvlrwlpppetpmtshiryevdvsagngagsvqrveile
grtecvlsnlrgrtrytfavrarmaepsfggfwsawsepvslltpsdl

SCOPe Domain Coordinates for d2jixb2:

Click to download the PDB-style file with coordinates for d2jixb2.
(The format of our PDB-style files is described here.)

Timeline for d2jixb2: