Lineage for d2jiwa3 (2jiw A:4-126)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1034471Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1035255Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (3 families) (S)
    contains similar fold but lacks its catalytic centre
  5. 1035324Family d.92.2.3: Hyaluronidase N-terminal domain-like [143618] (2 proteins)
  6. 1035325Protein Glucosaminidase GH84, N-terminal domain [143621] (1 species)
  7. 1035326Species Bacteroides thetaiotaomicron [TaxId:818] [143622] (7 PDB entries)
    Uniprot Q89ZI2 25-147
  8. 1035334Domain d2jiwa3: 2jiw A:4-126 [148103]
    Other proteins in same PDB: d2jiwa1, d2jiwa2, d2jiwb1, d2jiwb2
    automatically matched to 2J4G A:4-126
    complexed with beu

Details for d2jiwa3

PDB Entry: 2jiw (more details), 1.95 Å

PDB Description: bacteroides thetaiotaomicron gh84 o-glcnacase in complex with 2-acetylamino-2-deoxy-1-epivalienamine
PDB Compounds: (A:) o-glcnacase bt_4395

SCOPe Domain Sequences for d2jiwa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jiwa3 d.92.2.3 (A:4-126) Glucosaminidase GH84, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]}
slqpppqqlivqnktidlpavyqlnggeeanphavkvlkellsgkqsskkgmlisigekg
dksvrkysrqipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpeveikd
yps

SCOPe Domain Coordinates for d2jiwa3:

Click to download the PDB-style file with coordinates for d2jiwa3.
(The format of our PDB-style files is described here.)

Timeline for d2jiwa3: