SCOP 1.75: Domain d2jiwa2: 2jiw A:127-436

Lineage for d2jiwa2 (2jiw A:127-436)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (14 families)

5. Family c.1.8.10: alpha-D-glucuronidase/Hyaluronidase catalytic domain [82253] (3 proteins)
   Glycosyl hydrolase family 67, GH67; structurally related to GH20; contains extra C-terminal alpha-helical subdomain

6. Protein Glucosaminidase GH84, catalytic domain [141790] (1 species)

7. Species Bacteroides thetaiotaomicron [TaxId:818] [141791] (7 PDB entries)
   Uniprot Q89ZI2 148-457

8. Domain d2jiwa2: 2jiw A:127-436 [148102]
   Other proteins in same PDB: d2jiwa1, d2jiwa3, d2jiwb1, d2jiwb3
   automatically matched to 2J4G A:127-436
   complexed with beu

Details for d2jiwa2

PDB Entry: 2jiw, 1.95 Å

PDB Description: bacteroides thetaiotaomicron gh84 o-glcnacase in complex with 2-acetylamino-2-deoxy-1-epivalienamine

PDB Compounds: (A:) o-glcnacase bt_4395

SCOP Domain Sequences for d2jiwa2:

Sequence; same for both SEQRES and ATOM records:

>d2jiwa2 c.1.8.10 (A:127-436) Glucosaminidase GH84, catalytic domain {Bacteroides thetaiotaomicron [TaxId: 818]}
vryrgvvegfygtpwshqarlsqlkfygknkmntyiygpkddpyhsapnwrlpypdkeaa
qlqelvavanenevdfvwaihpgqdikwnkedrdlllakfekmyqlgvrsfavffddisg
egtnpqkqaellnyidekfaqvkpdinqlvmcpteynkswsnpngnylttlgdklnpsiq
imwtgdrvisditrdgiswinerikrpayiwwnfpvsdyvrdhlllgpvygndttiakem
sgfvtnpmehaesskiaiysvasyawnpakydtwqtwkdairtilpsaaeelecfamhns
dlgpnghgyr

Timeline for d2jiwa2:

• d2jiwa2 is new in SCOP 1.75
  
• d2jiwa2 appears in SCOPe 2.01
  
• d2jiwa2 appears in the current release, SCOPe 2.08