SCOP 1.75: Domain d2jida2: 2jid A:509-766

Lineage for d2jida2 (2jid A:509-766)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (41 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.24: DPP6 catalytic domain-like [82497] (2 proteins)
   N-terminal domain is a 8-bladed beta-propeller

6. Protein Dipeptidyl peptidase IV/CD26, C-terminal domain [82498] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82499] (29 PDB entries)
   Uniprot P27487 39-776
   Uniprot P27487
   Uniprot P27487
   Uniprot P27487 39-776 ! Uniprot P27487 ! Uniprot P27487

8. Domain d2jida2: 2jid A:509-766 [148088]
   Other proteins in same PDB: d2jida1, d2jidb1
   automatically matched to d1orva2
   complexed with gvb, nag

Details for d2jida2

PDB Entry: 2jid, 2.8 Å

PDB Description: human dipeptidyl peptidase iv in complex with 1-(3,4-dimethoxy-phenyl) -3-m-tolyl-piperidine-4-ylamine

PDB Compounds: (A:) dipeptidyl peptidase 4

SCOP Domain Sequences for d2jida2:

Sequence; same for both SEQRES and ATOM records:

>d2jida2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah
qhiythmshfikqcfslp

Timeline for d2jida2:

• d2jida2 is new in SCOP 1.75
  
• d2jida2 appears in SCOPe 2.01
  
• d2jida2 appears in the current release, SCOPe 2.08