SCOPe 2.04: Domain d2jiba3: 2jib A:370-565

Lineage for d2jiba3 (2jib A:370-565)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.9: Pyruvate oxidase and decarboxylase PP module [88749] (8 proteins)
   the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology

6. Protein Oxalyl-CoA decarboxylase [142209] (1 species)

7. Species Oxalobacter formigenes [TaxId:847] [142210] (6 PDB entries)
   Uniprot P40149 370-552

8. Domain d2jiba3: 2jib A:370-565 [148082]
   Other proteins in same PDB: d2jiba1, d2jiba2, d2jibb1, d2jibb2
   automated match to d2c31a3
   complexed with adp, coa, mg, pge, tpp

Details for d2jiba3

PDB Entry: 2jib, 2.2 Å

PDB Description: x-ray structure of oxalyl-coa decarboxylase in complex with coenzyme-a

PDB Compounds: (A:) oxalyl-coa decarboxylase

SCOPe Domain Sequences for d2jiba3:

Sequence; same for both SEQRES and ATOM records:

>d2jiba3 c.36.1.9 (A:370-565) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]}
tpsgmmnysnslgvvrdfmlanpdislvneganaldntrmivdmlkprkrldsgtwgvmg
igmgycvaaaavtgkpviavegdsafgfsgmeleticrynlpvtviimnnggiykgnead
pqpgvisctrltrgrydmmmeafggkgyvantpaelkaaleeavasgkpclinamidpda
gvesgrikslnvvskv

Timeline for d2jiba3:

• d2jiba3 first appeared in SCOP 1.75
  
• d2jiba3 appears in SCOPe 2.03
  
• d2jiba3 appears in SCOPe 2.05
  
• d2jiba3 appears in the current release, SCOPe 2.08