![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.287: DNA methylase specificity domain [116733] (1 superfamily) comprises the N-terminal, double beta-helix like structure and C-terminal alpha-hairpin |
![]() | Superfamily d.287.1: DNA methylase specificity domain [116734] (2 families) ![]() |
![]() | Family d.287.1.1: TaqI C-terminal domain-like [116735] (2 proteins) |
![]() | Protein automated matches [254552] (1 species) not a true protein |
![]() | Species Thermus aquaticus [TaxId:271] [255261] (1 PDB entry) |
![]() | Domain d2jg3d2: 2jg3 D:244-414 [148038] Other proteins in same PDB: d2jg3a1, d2jg3d1 automated match to d2adma2 protein/DNA complex; complexed with ba2, gol, k |
PDB Entry: 2jg3 (more details), 1.9 Å
SCOPe Domain Sequences for d2jg3d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jg3d2 d.287.1.1 (D:244-414) automated matches {Thermus aquaticus [TaxId: 271]} rfeteetrkleisgmplgdlfhirfaarspefkkhpavrkepgpglvpvltgrnlkpgwv dyeknhsglwmpkerakelrdfyatphlvvahtkgtrvvaawderaypwreefhllpkeg vrldpsslvqwlnseamqkhvrtlyrdfvphltlrmlerlpvrreygfhts
Timeline for d2jg3d2: