![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) ![]() |
![]() | Family c.66.1.27: DNA methylase TaqI, N-terminal domain [88787] (1 protein) |
![]() | Protein DNA methylase TaqI, N-terminal domain [53369] (1 species) |
![]() | Species Thermus aquaticus [TaxId:271] [53370] (12 PDB entries) |
![]() | Domain d2jg3d1: 2jg3 D:23-243 [148037] Other proteins in same PDB: d2jg3a2, d2jg3d2 automatically matched to d1aqia1 protein/DNA complex; complexed with ba2, gol, k |
PDB Entry: 2jg3 (more details), 1.9 Å
SCOPe Domain Sequences for d2jg3d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jg3d1 c.66.1.27 (D:23-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} tppevvdfmvslaeaprggrvlepacahgpflrafreahgtayrfvgveidpkaldlppw aegiladfllwepgeafdlilgnppygivgeaskypihvfkavkdlykkafstwkgkynl ygaflekavrllkpggvlvfvvpatwlvledfallreflaregktsvyylgevfpqkkvs avvirfqksgkglslwdtqesesgftpilwaeyphwegeii
Timeline for d2jg3d1: