SCOPe 2.04: Domain d2jg3a2: 2jg3 A:244-414

Lineage for d2jg3a2 (2jg3 A:244-414)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.287: DNA methylase specificity domain [116733] (1 superfamily)
   comprises the N-terminal, double beta-helix like structure and C-terminal alpha-hairpin

4. Superfamily d.287.1: DNA methylase specificity domain [116734] (2 families)

5. Family d.287.1.1: TaqI C-terminal domain-like [116735] (2 proteins)

6. Protein automated matches [254552] (1 species)
   not a true protein

7. Species Thermus aquaticus [TaxId:271] [255261] (1 PDB entry)

8. Domain d2jg3a2: 2jg3 A:244-414 [148036]
   Other proteins in same PDB: d2jg3a1, d2jg3d1
   automated match to d2adma2
   protein/DNA complex; complexed with ba2, gol, k

Details for d2jg3a2

PDB Entry: 2jg3, 1.9 Å

PDB Description: mtaqi with baz

PDB Compounds: (A:) modification methylase taqi

SCOPe Domain Sequences for d2jg3a2:

Sequence; same for both SEQRES and ATOM records:

>d2jg3a2 d.287.1.1 (A:244-414) automated matches {Thermus aquaticus [TaxId: 271]}
rfeteetrkleisgmplgdlfhirfaarspefkkhpavrkepgpglvpvltgrnlkpgwv
dyeknhsglwmpkerakelrdfyatphlvvahtkgtrvvaawderaypwreefhllpkeg
vrldpsslvqwlnseamqkhvrtlyrdfvphltlrmlerlpvrreygfhts

Timeline for d2jg3a2:

• d2jg3a2 first appeared in SCOP 1.75
  
• d2jg3a2 appears in SCOPe 2.03
  
• d2jg3a2 appears in SCOPe 2.05
  
• d2jg3a2 appears in the current release, SCOPe 2.08