Lineage for d2jg0a1 (2jg0 A:37-547)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 774162Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 774163Superfamily a.102.1: Six-hairpin glycosidases [48208] (9 families) (S)
  5. 774319Family a.102.1.9: Trehalase-like [158742] (1 protein)
    Pham 01204
  6. 774320Protein Periplasmic trehalase TreA [158743] (1 species)
  7. 774321Species Escherichia coli [TaxId:562] [158744] (2 PDB entries)
    Uniprot P13482 37-547
  8. 774322Domain d2jg0a1: 2jg0 A:37-547 [148034]
    automatically matched to 2JF4 A:37-547
    complexed with ttz

Details for d2jg0a1

PDB Entry: 2jg0 (more details), 1.5 Å

PDB Description: family 37 trehalase from escherichia coli in complex with 1-thiatrehazolin
PDB Compounds: (A:) periplasmic trehalase

SCOP Domain Sequences for d2jg0a1:

Sequence, based on SEQRES records: (download)

>d2jg0a1 a.102.1.9 (A:37-547) Periplasmic trehalase TreA {Escherichia coli [TaxId: 562]}
pqppdillgplfndvqnaklfpdqktfadavpnsdplmiladyrmqqnqsgfdlrhfvnv
nftlpkegekyvppegqslrehidglwpvltrstentekwdsllplpepyvvpggrfrev
yywdsyftmlglaesghwdkvadmvanfaheidtyghipngnrsyylsrsqppffalmve
llaqhegdaalkqylpqmqkeyaywmdgvenlqagqqekrvvklqdgtllnrywddrdtp
rpeswvediataksnpnrpateiyrdlrsaaasgwdfssrwmdnpqqlntlrttsivpvd
lnslmfkmekilaraskaagdnamanqyetlanarqkgiekylwndqqgwyadydlkshk
vrnqltaaalfplyvnaaakdrankmatatkthllqpgglnttsvksgqqwdapngwapl
qwvateglqnygqkevamdiswhfltnvqhtydrekklvekydvsttgtgggggeyplqd
gfgwtngvtlkmldlicpkeqpcdnvpatrp

Sequence, based on observed residues (ATOM records): (download)

>d2jg0a1 a.102.1.9 (A:37-547) Periplasmic trehalase TreA {Escherichia coli [TaxId: 562]}
pqppdillgplfndvqnaklfpdqktfadavpnsdplmiladyrmqqnqsgfdlrhfvnv
nftlpkyvppegqslrehidglwpvltrstentekwdsllplpepyvvpggrfrevyywd
syftmlglaesghwdkvadmvanfaheidtyghipngnrsyylsrsqppffalmvellaq
hegdaalkqylpqmqkeyaywmdgvenlqagqqekrvvklqdgtllnrywddrdtprpes
wvediataksnpnrpateiyrdlrsaaasgwdfssrwmdnpqqlntlrttsivpvdlnsl
mfkmekilaraskaagdnamanqyetlanarqkgiekylwndqqgwyadydlkshkvrnq
ltaaalfplyvnaaakdrankmatatkthllqpgglnttsvksgqqwdapngwaplqwva
teglqnygqkevamdiswhfltnvqhtydrekklvekydvsttgtgggggeyplqdgfgw
tngvtlkmldlicpkeqpcdnvpatrp

SCOP Domain Coordinates for d2jg0a1:

Click to download the PDB-style file with coordinates for d2jg0a1.
(The format of our PDB-style files is described here.)

Timeline for d2jg0a1: