SCOPe 2.03: Domain d2jfma_: 2jfm A:

Lineage for d2jfma_ (2jfm A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein STE20-like serine/threonine-protein kinase, SLK [160812] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [160813] (4 PDB entries)
   Uniprot Q9H2G2 21-308

8. Domain d2jfma_: 2jfm A: [148033]
   automated match to d2uv2a1
   complexed with edo

Details for d2jfma_

PDB Entry: 2jfm, 2.85 Å

PDB Description: crystal structure of human ste20-like kinase (unliganded form)

PDB Compounds: (A:) ste20-like serine-threonine kinase

SCOPe Domain Sequences for d2jfma_:

Sequence; same for both SEQRES and ATOM records:

>d2jfma_ d.144.1.7 (A:) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]}
yehvtrdlnpedfweiigelgdgafgkvykaqnketsvlaaakvidtkseeeledymvei
dilascdhpnivklldafyyennlwiliefcaggavdavmlelerpltesqiqvvckqtl
dalnylhdnkiihrdlkagnilftldgdikladfgvsakntrtiqrrdsfigtpywmape
vvmcetskdrpydykadvwslgitliemaeiepphhelnpmrvllkiaksepptlaqpsr
wssnfkdflkkcleknvdarwttsqllqhpfvtvdsnkpireliaeak

Timeline for d2jfma_:

• d2jfma_ first appeared in SCOP 1.75, called d2jfma1
  
• d2jfma_ was called d2jfma1 in SCOPe 2.02
  
• d2jfma_ appears in SCOPe 2.04
  
• d2jfma_ appears in the current release, SCOPe 2.08