SCOP 1.75: Domain d2jfma1: 2jfm A:21-308

Lineage for d2jfma1 (2jfm A:21-308)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (63 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein STE20-like serine/threonine-protein kinase, SLK [160812] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [160813] (3 PDB entries)
   Uniprot Q9H2G2 21-308

8. Domain d2jfma1: 2jfm A:21-308 [148033]
   automatically matched to 2UV2 A:21-308
   complexed with edo

Details for d2jfma1

PDB Entry: 2jfm, 2.85 Å

PDB Description: crystal structure of human ste20-like kinase (unliganded form)

PDB Compounds: (A:) ste20-like serine-threonine kinase

SCOP Domain Sequences for d2jfma1:

Sequence; same for both SEQRES and ATOM records:

>d2jfma1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]}
yehvtrdlnpedfweiigelgdgafgkvykaqnketsvlaaakvidtkseeeledymvei
dilascdhpnivklldafyyennlwiliefcaggavdavmlelerpltesqiqvvckqtl
dalnylhdnkiihrdlkagnilftldgdikladfgvsakntrtiqrrdsfigtpywmape
vvmcetskdrpydykadvwslgitliemaeiepphhelnpmrvllkiaksepptlaqpsr
wssnfkdflkkcleknvdarwttsqllqhpfvtvdsnkpireliaeak

Timeline for d2jfma1:

• d2jfma1 is new in SCOP 1.75
  
• d2jfma1 appears in SCOPe 2.01
  
• d2jfma1 appears in the current release, SCOPe 2.08, called d2jfma_