Lineage for d2jeba1 (2jeb A:-1-191)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1636635Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 1636636Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 1636876Family d.14.1.4: Ribonuclease PH domain 1-like [54229] (11 proteins)
  6. 1636938Protein Exosome complex exonuclease 2,ECX2 [159920] (2 species)
  7. 1636952Species Sulfolobus solfataricus [TaxId:2287] [159922] (6 PDB entries)
    Uniprot Q9UXC0 1-191
  8. 1636956Domain d2jeba1: 2jeb A:-1-191 [148015]
    Other proteins in same PDB: d2jeba2, d2jebb1, d2jebb2, d2jebi1, d2jebi2
    automated match to d2je6a1
    complexed with 1pe, cl, mn

Details for d2jeba1

PDB Entry: 2jeb (more details), 2.4 Å

PDB Description: structure of a 9-subunit archaeal exosome bound to mn ions
PDB Compounds: (A:) exosome complex exonuclease 2

SCOPe Domain Sequences for d2jeba1:

Sequence, based on SEQRES records: (download)

>d2jeba1 d.14.1.4 (A:-1-191) Exosome complex exonuclease 2,ECX2 {Sulfolobus solfataricus [TaxId: 2287]}
ghmsstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvkl
gttmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrsl
rdskaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhsn
gisvnknevvgkl

Sequence, based on observed residues (ATOM records): (download)

>d2jeba1 d.14.1.4 (A:-1-191) Exosome complex exonuclease 2,ECX2 {Sulfolobus solfataricus [TaxId: 2287]}
ghmsstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvkl
gttmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrsl
rdskaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqisv
nknevvgkl

SCOPe Domain Coordinates for d2jeba1:

Click to download the PDB-style file with coordinates for d2jeba1.
(The format of our PDB-style files is described here.)

Timeline for d2jeba1: