Lineage for d2jeba1 (2jeb A:1-191)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 852984Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 852985Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) (S)
  5. 853223Family d.14.1.4: Ribonuclease PH domain 1-like [54229] (10 proteins)
  6. 853283Protein Exosome complex exonuclease 2,ECX2 [159920] (2 species)
  7. 853291Species Sulfolobus solfataricus [TaxId:2287] [159922] (7 PDB entries)
    Uniprot Q9UXC0 1-191
  8. 853294Domain d2jeba1: 2jeb A:1-191 [148015]
    Other proteins in same PDB: d2jeba2, d2jebb1, d2jebb2
    automatically matched to 2JE6 A:1-191
    complexed with 1pe, cl, mn; mutant

Details for d2jeba1

PDB Entry: 2jeb (more details), 2.4 Å

PDB Description: structure of a 9-subunit archaeal exosome bound to mn ions
PDB Compounds: (A:) exosome complex exonuclease 2

SCOP Domain Sequences for d2jeba1:

Sequence, based on SEQRES records: (download)

>d2jeba1 d.14.1.4 (A:1-191) Exosome complex exonuclease 2,ECX2 {Sulfolobus solfataricus [TaxId: 2287]}
msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhsngi
svnknevvgkl

Sequence, based on observed residues (ATOM records): (download)

>d2jeba1 d.14.1.4 (A:1-191) Exosome complex exonuclease 2,ECX2 {Sulfolobus solfataricus [TaxId: 2287]}
msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqisvnk
nevvgkl

SCOP Domain Coordinates for d2jeba1:

Click to download the PDB-style file with coordinates for d2jeba1.
(The format of our PDB-style files is described here.)

Timeline for d2jeba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2jeba2