Class b: All beta proteins [48724] (176 folds) |
Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.4: Ribosomal L27 protein-like [110324] (3 families) rudiment single hybrid fold with a permuted topology |
Family b.84.4.2: ECR1 N-terminal domain-like [159324] (4 proteins) ECR1 - Exosome complex RNA-binding protein 1 |
Protein Exosome complex RNA-binding protein 1, ECR1 [159329] (2 species) |
Species Sulfolobus solfataricus [TaxId:2287] [159331] (4 PDB entries) Uniprot Q9UXC4 7-65 |
Domain d2jeai2: 2jea I:7-65 [148013] Other proteins in same PDB: d2jeaa1, d2jeaa2, d2jeab1, d2jeab2, d2jeai1, d2jeai3 automated match to d2je6i2 protein/RNA complex; complexed with 1pe |
PDB Entry: 2jea (more details), 2.33 Å
SCOPe Domain Sequences for d2jeai2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jeai2 b.84.4.2 (I:7-65) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} qeivlqprsivvpgellaegefqipwspyilkinskyystvvglfdvkdtqfevipleg
Timeline for d2jeai2:
View in 3D Domains from other chains: (mouse over for more information) d2jeaa1, d2jeaa2, d2jeab1, d2jeab2 |