Lineage for d2jeab1 (2jea B:8-155)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1891698Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 1891699Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 1891941Family d.14.1.4: Ribonuclease PH domain 1-like [54229] (11 proteins)
  6. 1891942Protein Exosome complex exonuclease 1, ECX1 [159923] (2 species)
  7. 1891950Species Sulfolobus solfataricus [TaxId:2287] [159924] (9 PDB entries)
    Uniprot Q9UXC2 8-155
  8. 1891953Domain d2jeab1: 2jea B:8-155 [148010]
    Other proteins in same PDB: d2jeaa1, d2jeaa2, d2jeab2, d2jeai1, d2jeai2, d2jeai3
    automated match to d2je6b1
    protein/RNA complex; complexed with 1pe

Details for d2jeab1

PDB Entry: 2jea (more details), 2.33 Å

PDB Description: structure of a 9-subunit archaeal exosome bound to rna
PDB Compounds: (B:) exosome complex exonuclease 1

SCOPe Domain Sequences for d2jeab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jeab1 d.14.1.4 (B:8-155) Exosome complex exonuclease 1, ECX1 {Sulfolobus solfataricus [TaxId: 2287]}
erpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavygpkemhpr
hlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelfprtaidv
fteilqadagsrlvslmaaslaladagi

SCOPe Domain Coordinates for d2jeab1:

Click to download the PDB-style file with coordinates for d2jeab1.
(The format of our PDB-style files is described here.)

Timeline for d2jeab1: