Lineage for d2jeaa2 (2jea A:192-275)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1426090Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134
  4. 1426091Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (2 families) (S)
  5. 1426092Family d.101.1.1: Ribonuclease PH domain 2-like [55667] (11 proteins)
  6. 1426154Protein Exosome complex exonuclease 2, ECX2 [160597] (2 species)
  7. 1426165Species Sulfolobus solfataricus [TaxId:2287] [160599] (9 PDB entries)
    Uniprot Q9UXC0 192-275
  8. 1426168Domain d2jeaa2: 2jea A:192-275 [148009]
    Other proteins in same PDB: d2jeaa1, d2jeab1, d2jeab2, d2jeai1, d2jeai2, d2jeai3
    automated match to d2je6a2
    protein/RNA complex; complexed with 1pe

Details for d2jeaa2

PDB Entry: 2jea (more details), 2.33 Å

PDB Description: structure of a 9-subunit archaeal exosome bound to rna
PDB Compounds: (A:) exosome complex exonuclease 2

SCOPe Domain Sequences for d2jeaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jeaa2 d.101.1.1 (A:192-275) Exosome complex exonuclease 2, ECX2 {Sulfolobus solfataricus [TaxId: 2287]}
plnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkgsmslqdi
dqaentarstavklleelkkhlgi

SCOPe Domain Coordinates for d2jeaa2:

Click to download the PDB-style file with coordinates for d2jeaa2.
(The format of our PDB-style files is described here.)

Timeline for d2jeaa2: