Class b: All beta proteins [48724] (177 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins) |
Protein Beta-mannosidase [158959] (1 species) |
Species Bacteroides thetaiotaomicron [TaxId:818] [158960] (2 PDB entries) Uniprot Q8AAK6 28-219 |
Domain d2je8a4: 2je8 A:28-219 [148001] Other proteins in same PDB: d2je8a1, d2je8a2, d2je8a3, d2je8a5, d2je8b1, d2je8b2, d2je8b3, d2je8b5, d2je8b6 complexed with b3p, cl, gol |
PDB Entry: 2je8 (more details), 1.7 Å
SCOPe Domain Sequences for d2je8a4:
Sequence; same for both SEQRES and ATOM records: (download)
>d2je8a4 b.18.1.5 (A:28-219) Beta-mannosidase {Bacteroides thetaiotaomicron [TaxId: 818]} ndtsevmlldtgwefsqsgtekwmpatvpgtvhqdlishellpnpfygmnekkiqwvene dweyrtsfivseeqlnrdgiqlifegldtyadvylngslllkadnmfvgytlpvksvlrk genhlyiyfhspirqtlpqyasngfnypadndhhekhlsvfsrkapysygwdwgirmvts gvwrpvtlrfyd
Timeline for d2je8a4: