Lineage for d2je6i2 (2je6 I:7-65)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1560127Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 1560426Superfamily b.84.4: Ribosomal L27 protein-like [110324] (3 families) (S)
    rudiment single hybrid fold with a permuted topology
  5. 1560477Family b.84.4.2: ECR1 N-terminal domain-like [159324] (4 proteins)
    ECR1 - Exosome complex RNA-binding protein 1
  6. 1560478Protein Exosome complex RNA-binding protein 1, ECR1 [159329] (2 species)
  7. 1560483Species Sulfolobus solfataricus [TaxId:2287] [159331] (4 PDB entries)
    Uniprot Q9UXC4 7-65
  8. 1560484Domain d2je6i2: 2je6 I:7-65 [147996]
    Other proteins in same PDB: d2je6a1, d2je6a2, d2je6b1, d2je6b2, d2je6i1, d2je6i3
    complexed with 1pe, cl, peg

Details for d2je6i2

PDB Entry: 2je6 (more details), 1.6 Å

PDB Description: structure of a 9-subunit archaeal exosome
PDB Compounds: (I:) exosome complex RNA-binding protein 1

SCOPe Domain Sequences for d2je6i2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2je6i2 b.84.4.2 (I:7-65) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]}
qeivlqprsivvpgellaegefqipwspyilkinskyystvvglfdvkdtqfevipleg

SCOPe Domain Coordinates for d2je6i2:

Click to download the PDB-style file with coordinates for d2je6i2.
(The format of our PDB-style files is described here.)

Timeline for d2je6i2: