Lineage for d2jdqd_ (2jdq D:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1689661Fold d.361: PB2 C-terminal domain-like [160452] (1 superfamily)
    alpha-beta-alpha-X-alpha-beta(2); 3 layers, a/b/a; antiparallel beta-sheet, order 132; connection between helices 2 and 3 runs over the edge of the beta-sheet
  4. 1689662Superfamily d.361.1: PB2 C-terminal domain-like [160453] (1 family) (S)
    automatically mapped to Pfam PF00604
  5. 1689663Family d.361.1.1: PB2 C-terminal domain-like [160454] (2 proteins)
    C-terminal part of Pfam PF00604
  6. 1689667Protein automated matches [190735] (1 species)
    not a true protein
  7. 1689668Species Influenza A virus [TaxId:11320] [187910] (1 PDB entry)
  8. 1689669Domain d2jdqd_: 2jdq D: [147989]
    Other proteins in same PDB: d2jdqa_, d2jdqb_
    automated match to d2gmoa1
    protein/RNA complex

Details for d2jdqd_

PDB Entry: 2jdq (more details), 2.2 Å

PDB Description: c-terminal domain of influenza a virus polymerase pb2 subunit in complex with human importin alpha5
PDB Compounds: (D:) Polymerase basic protein 2

SCOPe Domain Sequences for d2jdqd_:

Sequence, based on SEQRES records: (download)

>d2jdqd_ d.361.1.1 (D:) automated matches {Influenza A virus [TaxId: 11320]}
savlrgflilgkedrrygpalsinelsnlakgekanvligqgdvvlvmkrkrdssiltds
qtatkrirm

Sequence, based on observed residues (ATOM records): (download)

>d2jdqd_ d.361.1.1 (D:) automated matches {Influenza A virus [TaxId: 11320]}
savlrgflilgkedrrygpalsinelsnlakgekanvligqgdvvlvmkrkrdsqtatkr
irm

SCOPe Domain Coordinates for d2jdqd_:

Click to download the PDB-style file with coordinates for d2jdqd_.
(The format of our PDB-style files is described here.)

Timeline for d2jdqd_: