Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.361: PB2 C-terminal domain-like [160452] (1 superfamily) alpha-beta-alpha-X-alpha-beta(2); 3 layers, a/b/a; antiparallel beta-sheet, order 132; connection between helices 2 and 3 runs over the edge of the beta-sheet |
Superfamily d.361.1: PB2 C-terminal domain-like [160453] (1 family) automatically mapped to Pfam PF00604 |
Family d.361.1.1: PB2 C-terminal domain-like [160454] (2 proteins) C-terminal part of Pfam PF00604 |
Protein automated matches [190735] (1 species) not a true protein |
Species Influenza A virus [TaxId:11320] [187910] (1 PDB entry) |
Domain d2jdqd_: 2jdq D: [147989] Other proteins in same PDB: d2jdqa_ automated match to d2gmoa1 protein/RNA complex |
PDB Entry: 2jdq (more details), 2.2 Å
SCOPe Domain Sequences for d2jdqd_:
Sequence, based on SEQRES records: (download)
>d2jdqd_ d.361.1.1 (D:) automated matches {Influenza A virus [TaxId: 11320]} savlrgflilgkedrrygpalsinelsnlakgekanvligqgdvvlvmkrkrdssiltds qtatkrirm
>d2jdqd_ d.361.1.1 (D:) automated matches {Influenza A virus [TaxId: 11320]} savlrgflilgkedrrygpalsinelsnlakgekanvligqgdvvlvmkrkrdsqtatkr irm
Timeline for d2jdqd_: