SCOPe 2.03: Domain d2jccm1: 2jcc M:1-117

Lineage for d2jccm1 (2jcc M:1-117)

Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
Protein T-cell antigen receptor [48933] (6 species)
sequences may differ within each classified species
Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (29 PDB entries)
Domain d2jccm1: 2jcc M:1-117 [147975]
Other proteins in same PDB: d2jcca1, d2jcca2, d2jccb_, d2jcce2, d2jccf2, d2jcch1, d2jcch2, d2jcci_, d2jccl2, d2jccm2
automatically matched to d1lp9f1
mutant

Details for d2jccm1

PDB Entry: 2jcc (more details), 2.5 Å

PDB Description: ah3 recognition of mutant hla-a2 w167a

PDB Compounds: (M:) tcr beta

SCOPe Domain Sequences for d2jccm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jccm1 b.1.1.1 (M:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]}
eaavtqsprskvavtggkvtlschqtnnhdymywyrqdtghglrlihysyvadstekgdi
pdgykasrpsqenfslilelaslsqtavyfcassdwvsyeqyfgpgtrltvle

SCOPe Domain Coordinates for d2jccm1:

Click to download the PDB-style file with coordinates for d2jccm1.
(The format of our PDB-style files is described here.)

Timeline for d2jccm1: